Products Categories
    Product Certification&
    Enterprise Certification

  • Mr.Alex Gu
    Tel: 86-0-18115476705

  • Mobile:18115476705
  • Tel:86-0-18115476705
  • Fax:
  • Province/state:Jiangsu
  • City:Nanjing
  • Street:building F, No.22, Tiansheng Road, Jiangbei new district, Nanjing
  • MaxCard:
Home > Products >  Amyloid β-Protein (1-40) (mouse, rat)

Amyloid β-Protein (1-40) (mouse, rat) CAS NO.144409-98-3

  • Min.Order: 0 Metric Ton
  • Payment Terms:
  • Product Details

Keywords

  • 144409-98-3
  • Amyloid
  • β-Amyloid (1-40)

Quick Details

  • ProName: Amyloid β-Protein (1-40) (mouse, rat)
  • CasNo: 144409-98-3
  • Molecular Formula: C???H???N??O??S
  • Application: Alzheimer's Disease
  • ProductionCapacity: Metric Ton/Day
  • Purity: 95%
  • Storage: -20 ± 5 °C
  • LimitNum: 0 Metric Ton

Superiority

Nanjing TGpeptide Biotechnology Co.,Ltd.("TGpeptide" hereafter), who is founded in 2019, located at Jiangbei New Material Industrial Park, is a professional enterprise enageged in researching, developing, manufacturing and sales of peptide, antibody and protein products and their technologies.
   Range of Services:
1, Linear peptides: Quantity from mg to kg, up to 180 residues.
2, The range of purity: Crude、Desalted、>70%、>80%、>90%、>95%、>98%、>99%.
3, Peptide modifications: C-terminal modifications, N-terminal modifications, Fluorescence and Dye Labeling Peptides, Cyclic Peptides Synthesis, Phosphopeptides etc.
4, Peptides with different structures: Linear peptides, MAPs, Cyclic peptides etc.
5, Antigen peptides: KLH, BSA, 0VA coupling.
6, Different packages: we can make aliquots according to the demand of customers, and it's free.

Details

107P37
H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
β-Amyloid (1-40), rat 
C???H???N??O??S
4233.78
144409-98-3
Synthetic
-20 ± 5 °C
Alzheimer's Disease

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog