China (Mainland)
Amyloid β-Protein (1-40) (mouse, rat) CAS NO.144409-98-3
- Min.Order: 0 Metric Ton
- Payment Terms:
- Product Details
Keywords
- 144409-98-3
- Amyloid
- β-Amyloid (1-40)
Quick Details
- ProName: Amyloid β-Protein (1-40) (mouse, rat)
- CasNo: 144409-98-3
- Molecular Formula: C???H???N??O??S
- Application: Alzheimer's Disease
- ProductionCapacity: Metric Ton/Day
- Purity: 95%
- Storage: -20 ± 5 °C
- LimitNum: 0 Metric Ton
Superiority
Nanjing TGpeptide Biotechnology Co.,Ltd.("TGpeptide" hereafter), who is founded in 2019, located at Jiangbei New Material Industrial Park, is a professional enterprise enageged in researching, developing, manufacturing and sales of peptide, antibody and protein products and their technologies.
Range of Services：
1, Linear peptides: Quantity from mg to kg, up to 180 residues.
2, The range of purity: Crude、Desalted、＞70%、＞80%、＞90%、＞95%、＞98%、＞99%.
3, Peptide modifications: C-terminal modifications, N-terminal modifications, Fluorescence and Dye Labeling Peptides, Cyclic Peptides Synthesis, Phosphopeptides etc.
4, Peptides with different structures: Linear peptides, MAPs, Cyclic peptides etc.
5, Antigen peptides: KLH, BSA, 0VA coupling.
6, Different packages: we can make aliquots according to the demand of customers, and it's free.
Details
| 107P37 |
| H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| β-Amyloid (1-40), rat |
| C???H???N??O??S |
| 4233.78 |
| 144409-98-3 |
| Synthetic |
| -20 ± 5 °C |
| Alzheimer's Disease |