China (Mainland)
Amyloid β-Protein (1-40) CAS NO.131438-79-4
- Min.Order: 0 Metric Ton
- Payment Terms:
- Product Details
Keywords
- 131438-79-4
- Aβ40
- Amyloid
Quick Details
- ProName: Amyloid β-Protein (1-40)
- CasNo: 131438-79-4
- Application: Alzheimer's Disease
- ProductionCapacity: Metric Ton/Day
- Purity: 95%
- Storage: -20 ± 5 °C
- LimitNum: 0 Metric Ton
Superiority
Nanjing TGpeptide Biotechnology Co.,Ltd.("TGpeptide" hereafter), who is founded in 2019, located at Jiangbei New Material Industrial Park, is a professional enterprise enageged in researching, developing, manufacturing and sales of peptide, antibody and protein products and their technologies.
Range of Services：
1, Linear peptides: Quantity from mg to kg, up to 180 residues.
2, The range of purity: Crude、Desalted、＞70%、＞80%、＞90%、＞95%、＞98%、＞99%.
3, Peptide modifications: C-terminal modifications, N-terminal modifications, Fluorescence and Dye Labeling Peptides, Cyclic Peptides Synthesis, Phosphopeptides etc.
4, Peptides with different structures: Linear peptides, MAPs, Cyclic peptides etc.
5, Antigen peptides: KLH, BSA, 0VA coupling.
6, Different packages: we can make aliquots according to the demand of customers, and it's free.
Details
| 107P33 |
| H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Aβ40 |
| C???H???N??O??S |
| 4329.86 |
| 131438-79-4 |
| Synthetic |
| -20 ± 5 °C |
| Alzheimer's Disease |
|
Amyloid β-peptide (1-40) showed both neurotrophic and neurotoxic effects in dependence on the neuronal age and the concentration of the β-protein. Aβ 1-40 has been used as well as Aβ 1-42 to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients. The sequence of H-1194 corresponds to the human, bovine, canine, feline, ovine, guinea pig, and rabbit Aβ40 peptide. Besides the TFA salt, Bachem offers the HCl salt of the peptide. The inverted sequence, can be used as inactive control in experiments employing Aβ 1-40. For detailed descriptions of the preparation of wild-type and mutant Aβ 1-40 monomers and protofibrils please see the paper of Jan, Hartley, and Lashuel. |